CLK3 monoclonal antibody (M01), clone 1H2
  • CLK3 monoclonal antibody (M01), clone 1H2

CLK3 monoclonal antibody (M01), clone 1H2

Ref: AB-H00001198-M01
CLK3 monoclonal antibody (M01), clone 1H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLK3.
Información adicional
Size 100 ug
Gene Name CLK3
Gene Alias FLJ22858|PHCLK3|PHCLK3/152
Gene Description CDC-like kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,ELISA
Immunogen Prot. Seq YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLK3 (AAH02555, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1198
Clone Number 1H2
Iso type IgG2b Kappa

Enviar uma mensagem


CLK3 monoclonal antibody (M01), clone 1H2

CLK3 monoclonal antibody (M01), clone 1H2