CLIC1 polyclonal antibody (A01)
  • CLIC1 polyclonal antibody (A01)

CLIC1 polyclonal antibody (A01)

Ref: AB-H00001192-A01
CLIC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CLIC1.
Información adicional
Size 50 uL
Gene Name CLIC1
Gene Alias G6|NCC27
Gene Description chloride intracellular channel 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLIC1 (AAH64527.1, 1 a.a. ~ 241 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1192

Enviar uma mensagem


CLIC1 polyclonal antibody (A01)

CLIC1 polyclonal antibody (A01)