CLU purified MaxPab mouse polyclonal antibody (B01P)
  • CLU purified MaxPab mouse polyclonal antibody (B01P)

CLU purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001191-B01P
CLU purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CLU protein.
Información adicional
Size 50 ug
Gene Name CLU
Gene Alias AAG4|APOJ|CLI|KUB1|MGC24903|SGP-2|SGP2|SP-40|TRPM-2|TRPM2
Gene Description clusterin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CLU (ABM85549.1, 1 a.a. ~ 449 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1191

Enviar uma mensagem


CLU purified MaxPab mouse polyclonal antibody (B01P)

CLU purified MaxPab mouse polyclonal antibody (B01P)