CLU polyclonal antibody (A01)
  • CLU polyclonal antibody (A01)

CLU polyclonal antibody (A01)

Ref: AB-H00001191-A01
CLU polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CLU.
Información adicional
Size 50 uL
Gene Name CLU
Gene Alias AAG4|APOJ|CLI|KUB1|MGC24903|SGP-2|SGP2|SP-40|TRPM-2|TRPM2
Gene Description clusterin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLU (NP_001822, 402 a.a. ~ 501 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1191

Enviar uma mensagem


CLU polyclonal antibody (A01)

CLU polyclonal antibody (A01)