CLCN7 polyclonal antibody (A01)
  • CLCN7 polyclonal antibody (A01)

CLCN7 polyclonal antibody (A01)

Ref: AB-H00001186-A01
CLCN7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CLCN7.
Información adicional
Size 50 uL
Gene Name CLCN7
Gene Alias CLC-7|CLC7|FLJ26686|FLJ39644|FLJ46423|OPTA2|OPTB4
Gene Description chloride channel 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVTRKDLARYRLGKRGLEELSLAQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLCN7 (NP_001278, 706 a.a. ~ 805 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1186

Enviar uma mensagem


CLCN7 polyclonal antibody (A01)

CLCN7 polyclonal antibody (A01)