AP3S1 purified MaxPab mouse polyclonal antibody (B02P)
  • AP3S1 purified MaxPab mouse polyclonal antibody (B02P)

AP3S1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00001176-B02P
AP3S1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AP3S1 protein.
Información adicional
Size 50 ug
Gene Name AP3S1
Gene Alias CLAPS3|Sigma3A
Gene Description adaptor-related protein complex 3, sigma 1 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AP3S1 (NP_001275.1, 1 a.a. ~ 193 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1176

Enviar uma mensagem


AP3S1 purified MaxPab mouse polyclonal antibody (B02P)

AP3S1 purified MaxPab mouse polyclonal antibody (B02P)