AP2S1 monoclonal antibody (M01), clone 3E4
  • AP2S1 monoclonal antibody (M01), clone 3E4

AP2S1 monoclonal antibody (M01), clone 3E4

Ref: AB-H00001175-M01
AP2S1 monoclonal antibody (M01), clone 3E4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant AP2S1.
Información adicional
Size 100 ug
Gene Name AP2S1
Gene Alias AP17|AP17-DELTA|CLAPS2
Gene Description adaptor-related protein complex 2, sigma 1 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AP2S1 (AAH06337, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1175
Clone Number 3E4
Iso type IgG2a Kappa

Enviar uma mensagem


AP2S1 monoclonal antibody (M01), clone 3E4

AP2S1 monoclonal antibody (M01), clone 3E4