AP2S1 polyclonal antibody (A01)
  • AP2S1 polyclonal antibody (A01)

AP2S1 polyclonal antibody (A01)

Ref: AB-H00001175-A01
AP2S1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant AP2S1.
Información adicional
Size 50 uL
Gene Name AP2S1
Gene Alias AP17|AP17-DELTA|CLAPS2
Gene Description adaptor-related protein complex 2, sigma 1 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AP2S1 (AAH06337, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1175

Enviar uma mensagem


AP2S1 polyclonal antibody (A01)

AP2S1 polyclonal antibody (A01)