CKS2 monoclonal antibody (M06), clone 3A2
  • CKS2 monoclonal antibody (M06), clone 3A2

CKS2 monoclonal antibody (M06), clone 3A2

Ref: AB-H00001164-M06
CKS2 monoclonal antibody (M06), clone 3A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CKS2.
Información adicional
Size 100 ug
Gene Name CKS2
Gene Alias CKSHS2
Gene Description CDC28 protein kinase regulatory subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CKS2 (NP_001818.1, 1 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1164
Clone Number 3A2
Iso type IgG2a Kappa

Enviar uma mensagem


CKS2 monoclonal antibody (M06), clone 3A2

CKS2 monoclonal antibody (M06), clone 3A2