CKS2 purified MaxPab mouse polyclonal antibody (B01P)
  • CKS2 purified MaxPab mouse polyclonal antibody (B01P)

CKS2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001164-B01P
CKS2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CKS2 protein.
Información adicional
Size 50 ug
Gene Name CKS2
Gene Alias CKSHS2
Gene Description CDC28 protein kinase regulatory subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CKS2 (AAH06458.1, 1 a.a. ~ 79 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1164

Enviar uma mensagem


CKS2 purified MaxPab mouse polyclonal antibody (B01P)

CKS2 purified MaxPab mouse polyclonal antibody (B01P)