CKMT2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CKMT2 purified MaxPab rabbit polyclonal antibody (D01P)

CKMT2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001160-D01P
CKMT2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CKMT2 protein.
Información adicional
Size 100 ug
Gene Name CKMT2
Gene Alias SMTCK
Gene Description creatine kinase, mitochondrial 2 (sarcomeric)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CKMT2 (AAH29140.1, 1 a.a. ~ 419 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1160

Enviar uma mensagem


CKMT2 purified MaxPab rabbit polyclonal antibody (D01P)

CKMT2 purified MaxPab rabbit polyclonal antibody (D01P)