CKM purified MaxPab rabbit polyclonal antibody (D01P)
  • CKM purified MaxPab rabbit polyclonal antibody (D01P)

CKM purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001158-D01P
CKM purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CKM protein.
Información adicional
Size 100 ug
Gene Name CKM
Gene Alias CKMM|M-CK
Gene Description creatine kinase, muscle
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CKM (AAH07462.1, 1 a.a. ~ 381 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1158

Enviar uma mensagem


CKM purified MaxPab rabbit polyclonal antibody (D01P)

CKM purified MaxPab rabbit polyclonal antibody (D01P)