TBCB purified MaxPab mouse polyclonal antibody (B01P)
  • TBCB purified MaxPab mouse polyclonal antibody (B01P)

TBCB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001155-B01P
TBCB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TBCB protein.
Información adicional
Size 50 ug
Gene Name TBCB
Gene Alias CG22|CKAP1|CKAPI|MGC14625
Gene Description tubulin folding cofactor B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TBCB (AAH05969, 1 a.a. ~ 244 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1155

Enviar uma mensagem


TBCB purified MaxPab mouse polyclonal antibody (B01P)

TBCB purified MaxPab mouse polyclonal antibody (B01P)