CKB polyclonal antibody (A01)
  • CKB polyclonal antibody (A01)

CKB polyclonal antibody (A01)

Ref: AB-H00001152-A01
CKB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CKB.
Información adicional
Size 50 uL
Gene Name CKB
Gene Alias B-CK|CKBB
Gene Description creatine kinase, brain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CKB (AAH01190, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1152

Enviar uma mensagem


CKB polyclonal antibody (A01)

CKB polyclonal antibody (A01)