CHRNB4 polyclonal antibody (A01)
  • CHRNB4 polyclonal antibody (A01)

CHRNB4 polyclonal antibody (A01)

Ref: AB-H00001143-A01
CHRNB4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHRNB4.
Información adicional
Size 50 uL
Gene Name CHRNB4
Gene Alias -
Gene Description cholinergic receptor, nicotinic, beta 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHRNB4 (NP_000741, 68 a.a. ~ 177 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1143

Enviar uma mensagem


CHRNB4 polyclonal antibody (A01)

CHRNB4 polyclonal antibody (A01)