CHRNA5 monoclonal antibody (M01), clone 7D3
  • CHRNA5 monoclonal antibody (M01), clone 7D3

CHRNA5 monoclonal antibody (M01), clone 7D3

Ref: AB-H00001138-M01
CHRNA5 monoclonal antibody (M01), clone 7D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CHRNA5.
Información adicional
Size 100 ug
Gene Name CHRNA5
Gene Alias LNCR2
Gene Description cholinergic receptor, nicotinic, alpha 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHRNA5 (NP_000736, 38 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1138
Clone Number 7D3
Iso type IgG1 Kappa

Enviar uma mensagem


CHRNA5 monoclonal antibody (M01), clone 7D3

CHRNA5 monoclonal antibody (M01), clone 7D3