CHRM2 monoclonal antibody (M01), clone 4B5
  • CHRM2 monoclonal antibody (M01), clone 4B5

CHRM2 monoclonal antibody (M01), clone 4B5

Ref: AB-H00001129-M01
CHRM2 monoclonal antibody (M01), clone 4B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CHRM2.
Información adicional
Size 100 ug
Gene Name CHRM2
Gene Alias FLJ43243|HM2|MGC120006|MGC120007
Gene Description cholinergic receptor, muscarinic 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHRM2 (AAI06743.1, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1129
Clone Number 4B5
Iso type IgG2a Kappa

Enviar uma mensagem


CHRM2 monoclonal antibody (M01), clone 4B5

CHRM2 monoclonal antibody (M01), clone 4B5