CHKA polyclonal antibody (A01)
  • CHKA polyclonal antibody (A01)

CHKA polyclonal antibody (A01)

Ref: AB-H00001119-A01
CHKA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHKA.
Información adicional
Size 50 uL
Gene Name CHKA
Gene Alias CHK|CKI
Gene Description choline kinase alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHKA (NP_997634, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1119

Enviar uma mensagem


CHKA polyclonal antibody (A01)

CHKA polyclonal antibody (A01)