CHI3L1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CHI3L1 purified MaxPab rabbit polyclonal antibody (D01P)

CHI3L1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001116-D01P
CHI3L1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CHI3L1 protein.
Información adicional
Size 100 ug
Gene Name CHI3L1
Gene Alias ASRT7|DKFZp686N19119|FLJ38139|GP39|HC-gp39|HCGP-3P|YKL40|YYL-40
Gene Description chitinase 3-like 1 (cartilage glycoprotein-39)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGVKASQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHI3L1 (AAH08568.1, 1 a.a. ~ 383 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1116

Enviar uma mensagem


CHI3L1 purified MaxPab rabbit polyclonal antibody (D01P)

CHI3L1 purified MaxPab rabbit polyclonal antibody (D01P)