CHD2 polyclonal antibody (A01)
  • CHD2 polyclonal antibody (A01)

CHD2 polyclonal antibody (A01)

Ref: AB-H00001106-A01
CHD2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CHD2.
Información adicional
Size 50 uL
Gene Name CHD2
Gene Alias DKFZp547I1315|DKFZp686E01200|DKFZp781D1727|FLJ38614
Gene Description chromodomain helicase DNA binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESEQGSDPGSGHGSESNSSSESSESQSESESESAGSKSQPVLPEAKEKPASKKERIADVKKMWEEYPDVYGVRRSNRSRQEPSRFNIKEEASSGSESGSPKRRGQRQLKKQEKWKQEPSEDEQEQGTSAESEPEQKKVKARRPVPRRTVPKPRVKKQPKTQRGKRKKQDSSDEDDDDDEAPKRQTRRRAAKNVSYKEDDDFETDSDDLIEMTGEGVDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHD2 (AAH07347, 1 a.a. ~ 501 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1106

Enviar uma mensagem


CHD2 polyclonal antibody (A01)

CHD2 polyclonal antibody (A01)