CHD1 monoclonal antibody (M04), clone 1G2
  • CHD1 monoclonal antibody (M04), clone 1G2

CHD1 monoclonal antibody (M04), clone 1G2

Ref: AB-H00001105-M04
CHD1 monoclonal antibody (M04), clone 1G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CHD1.
Información adicional
Size 100 ug
Gene Name CHD1
Gene Alias DKFZp686E2337
Gene Description chromodomain helicase DNA binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHD1 (NP_001261, 1177 a.a. ~ 1272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1105
Clone Number 1G2
Iso type IgG2b Kappa

Enviar uma mensagem


CHD1 monoclonal antibody (M04), clone 1G2

CHD1 monoclonal antibody (M04), clone 1G2