CHD1 polyclonal antibody (A01)
  • CHD1 polyclonal antibody (A01)

CHD1 polyclonal antibody (A01)

Ref: AB-H00001105-A01
CHD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHD1.
Información adicional
Size 50 uL
Gene Name CHD1
Gene Alias DKFZp686E2337
Gene Description chromodomain helicase DNA binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHD1 (NP_001261, 1177 a.a. ~ 1272 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1105

Enviar uma mensagem


CHD1 polyclonal antibody (A01)

CHD1 polyclonal antibody (A01)