RCBTB2 monoclonal antibody (M06), clone 4G12
  • RCBTB2 monoclonal antibody (M06), clone 4G12

RCBTB2 monoclonal antibody (M06), clone 4G12

Ref: AB-H00001102-M06
RCBTB2 monoclonal antibody (M06), clone 4G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RCBTB2.
Información adicional
Size 50 ug
Gene Name RCBTB2
Gene Alias CHC1L
Gene Description regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCBTB2 (NP_001259, 86 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1102
Clone Number 4G12
Iso type IgG2a Kappa

Enviar uma mensagem


RCBTB2 monoclonal antibody (M06), clone 4G12

RCBTB2 monoclonal antibody (M06), clone 4G12