RCBTB2 monoclonal antibody (M01), clone 2G4
  • RCBTB2 monoclonal antibody (M01), clone 2G4

RCBTB2 monoclonal antibody (M01), clone 2G4

Ref: AB-H00001102-M01
RCBTB2 monoclonal antibody (M01), clone 2G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RCBTB2.
Información adicional
Size 100 ug
Gene Name RCBTB2
Gene Alias CHC1L
Gene Description regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCBTB2 (NP_001259, 86 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1102
Clone Number 2G4
Iso type IgG2b Kappa

Enviar uma mensagem


RCBTB2 monoclonal antibody (M01), clone 2G4

RCBTB2 monoclonal antibody (M01), clone 2G4