RCBTB2 polyclonal antibody (A01)
  • RCBTB2 polyclonal antibody (A01)

RCBTB2 polyclonal antibody (A01)

Ref: AB-H00001102-A01
RCBTB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RCBTB2.
Información adicional
Size 50 uL
Gene Name RCBTB2
Gene Alias CHC1L
Gene Description regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCBTB2 (NP_001259, 86 a.a. ~ 194 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1102

Enviar uma mensagem


RCBTB2 polyclonal antibody (A01)

RCBTB2 polyclonal antibody (A01)