CETN1 MaxPab rabbit polyclonal antibody (D01)
  • CETN1 MaxPab rabbit polyclonal antibody (D01)

CETN1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001068-D01
CETN1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CETN1 protein.
Información adicional
Size 100 uL
Gene Name CETN1
Gene Alias CEN1|CETN
Gene Description centrin, EF-hand protein, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CETN1 (NP_004057.1, 1 a.a. ~ 172 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1068

Enviar uma mensagem


CETN1 MaxPab rabbit polyclonal antibody (D01)

CETN1 MaxPab rabbit polyclonal antibody (D01)