CENPA monoclonal antibody (M01), clone 1D4-1A3
  • CENPA monoclonal antibody (M01), clone 1D4-1A3

CENPA monoclonal antibody (M01), clone 1D4-1A3

Ref: AB-H00001058-M01
CENPA monoclonal antibody (M01), clone 1D4-1A3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CENPA.
Información adicional
Size 100 ug
Gene Name CENPA
Gene Alias CENP-A
Gene Description centromere protein A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CENPA (AAH00881, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1058
Clone Number 1D4-1A3
Iso type IgG1 Kappa

Enviar uma mensagem


CENPA monoclonal antibody (M01), clone 1D4-1A3

CENPA monoclonal antibody (M01), clone 1D4-1A3