CEBPE polyclonal antibody (A01)
  • CEBPE polyclonal antibody (A01)

CEBPE polyclonal antibody (A01)

Ref: AB-H00001053-A01
CEBPE polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CEBPE.
Información adicional
Size 50 uL
Gene Name CEBPE
Gene Alias C/EBP-epsilon|CRP1
Gene Description CCAAT/enhancer binding protein (C/EBP), epsilon
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CEBPE (AAH35797.2, 1 a.a. ~ 281 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1053

Enviar uma mensagem


CEBPE polyclonal antibody (A01)

CEBPE polyclonal antibody (A01)