CDX4 monoclonal antibody (M09), clone 3H8
  • CDX4 monoclonal antibody (M09), clone 3H8

CDX4 monoclonal antibody (M09), clone 3H8

Ref: AB-H00001046-M09
CDX4 monoclonal antibody (M09), clone 3H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDX4.
Información adicional
Size 100 ug
Gene Name CDX4
Gene Alias -
Gene Description caudal type homeobox 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDX4 (NP_005184.1, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1046
Clone Number 3H8
Iso type IgG2a Kappa

Enviar uma mensagem


CDX4 monoclonal antibody (M09), clone 3H8

CDX4 monoclonal antibody (M09), clone 3H8