CDX1 monoclonal antibody (M08), clone 2E2
  • CDX1 monoclonal antibody (M08), clone 2E2

CDX1 monoclonal antibody (M08), clone 2E2

Ref: AB-H00001044-M08
CDX1 monoclonal antibody (M08), clone 2E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDX1.
Información adicional
Size 100 ug
Gene Name CDX1
Gene Alias MGC116915
Gene Description caudal type homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDX1 (NP_001795, 126 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1044
Clone Number 2E2
Iso type IgG2a Kappa

Enviar uma mensagem


CDX1 monoclonal antibody (M08), clone 2E2

CDX1 monoclonal antibody (M08), clone 2E2