CDO1 purified MaxPab mouse polyclonal antibody (B01P)
  • CDO1 purified MaxPab mouse polyclonal antibody (B01P)

CDO1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001036-B01P
CDO1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CDO1 protein.
Información adicional
Size 50 ug
Gene Name CDO1
Gene Alias -
Gene Description cysteine dioxygenase, type I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDO1 (NP_001792.2, 1 a.a. ~ 200 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1036

Enviar uma mensagem


CDO1 purified MaxPab mouse polyclonal antibody (B01P)

CDO1 purified MaxPab mouse polyclonal antibody (B01P)