CDKN2C purified MaxPab mouse polyclonal antibody (B02P)
  • CDKN2C purified MaxPab mouse polyclonal antibody (B02P)

CDKN2C purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00001031-B02P
CDKN2C purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CDKN2C protein.
Información adicional
Size 50 ug
Gene Name CDKN2C
Gene Alias INK4C|p18|p18-INK4C
Gene Description cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDKN2C (NP_001253.1, 1 a.a. ~ 168 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1031

Enviar uma mensagem


CDKN2C purified MaxPab mouse polyclonal antibody (B02P)

CDKN2C purified MaxPab mouse polyclonal antibody (B02P)