CDKN2B monoclonal antibody (M07), clone 8C4
  • CDKN2B monoclonal antibody (M07), clone 8C4

CDKN2B monoclonal antibody (M07), clone 8C4

Ref: AB-H00001030-M07
CDKN2B monoclonal antibody (M07), clone 8C4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CDKN2B.
Información adicional
Size 100 ug
Gene Name CDKN2B
Gene Alias CDK4I|INK4B|MTS2|P15|TP15|p15INK4b
Gene Description cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDKN2B (AAH14469, 1 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1030
Clone Number 8C4
Iso type IgG2a Kappa

Enviar uma mensagem


CDKN2B monoclonal antibody (M07), clone 8C4

CDKN2B monoclonal antibody (M07), clone 8C4