CDKN1B polyclonal antibody (A01)
  • CDKN1B polyclonal antibody (A01)

CDKN1B polyclonal antibody (A01)

Ref: AB-H00001027-A01
CDKN1B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CDKN1B.
Información adicional
Size 50 uL
Gene Name CDKN1B
Gene Alias CDKN4|KIP1|MEN1B|MEN4|P27KIP1
Gene Description cyclin-dependent kinase inhibitor 1B (p27, Kip1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDKN1B (AAH01971, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1027

Enviar uma mensagem


CDKN1B polyclonal antibody (A01)

CDKN1B polyclonal antibody (A01)