CDK8 monoclonal antibody (M04), clone 2E6
  • CDK8 monoclonal antibody (M04), clone 2E6

CDK8 monoclonal antibody (M04), clone 2E6

Ref: AB-H00001024-M04
CDK8 monoclonal antibody (M04), clone 2E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDK8.
Información adicional
Size 100 ug
Gene Name CDK8
Gene Alias K35|MGC126074|MGC126075
Gene Description cyclin-dependent kinase 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1024
Clone Number 2E6
Iso type IgG1 Kappa

Enviar uma mensagem


CDK8 monoclonal antibody (M04), clone 2E6

CDK8 monoclonal antibody (M04), clone 2E6