CDK8 monoclonal antibody (M01), clone 6H5
  • CDK8 monoclonal antibody (M01), clone 6H5

CDK8 monoclonal antibody (M01), clone 6H5

Ref: AB-H00001024-M01
CDK8 monoclonal antibody (M01), clone 6H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDK8.
Información adicional
Size 100 ug
Gene Name CDK8
Gene Alias K35|MGC126074|MGC126075
Gene Description cyclin-dependent kinase 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1024
Clone Number 6H5
Iso type IgG1 Kappa

Enviar uma mensagem


CDK8 monoclonal antibody (M01), clone 6H5

CDK8 monoclonal antibody (M01), clone 6H5