CDK6 purified MaxPab mouse polyclonal antibody (B01P)
  • CDK6 purified MaxPab mouse polyclonal antibody (B01P)

CDK6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001021-B01P
CDK6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CDK6 protein.
Información adicional
Size 50 ug
Gene Name CDK6
Gene Alias MGC59692|PLSTIRE|STQTL11
Gene Description cyclin-dependent kinase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDK6 (NP_001250.1, 1 a.a. ~ 326 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1021

Enviar uma mensagem


CDK6 purified MaxPab mouse polyclonal antibody (B01P)

CDK6 purified MaxPab mouse polyclonal antibody (B01P)