CDK5 MaxPab rabbit polyclonal antibody (D01)
  • CDK5 MaxPab rabbit polyclonal antibody (D01)

CDK5 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001020-D01
CDK5 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDK5 protein.
Información adicional
Size 100 uL
Gene Name CDK5
Gene Alias PSSALRE
Gene Description cyclin-dependent kinase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDK5 (NP_004926.1, 1 a.a. ~ 292 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1020

Enviar uma mensagem


CDK5 MaxPab rabbit polyclonal antibody (D01)

CDK5 MaxPab rabbit polyclonal antibody (D01)