CDK4 monoclonal antibody (M04), clone 2G7
  • CDK4 monoclonal antibody (M04), clone 2G7

CDK4 monoclonal antibody (M04), clone 2G7

Ref: AB-H00001019-M04
CDK4 monoclonal antibody (M04), clone 2G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDK4.
Información adicional
Size 100 ug
Gene Name CDK4
Gene Alias CMM3|MGC14458|PSK-J3
Gene Description cyclin-dependent kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1019
Clone Number 2G7
Iso type IgG1 Kappa

Enviar uma mensagem


CDK4 monoclonal antibody (M04), clone 2G7

CDK4 monoclonal antibody (M04), clone 2G7