CDK4 polyclonal antibody (A01)
  • CDK4 polyclonal antibody (A01)

CDK4 polyclonal antibody (A01)

Ref: AB-H00001019-A01
CDK4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CDK4.
Información adicional
Size 50 uL
Gene Name CDK4
Gene Alias CMM3|MGC14458|PSK-J3
Gene Description cyclin-dependent kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDK4 (AAH03644, 211 a.a. ~ 303 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1019

Enviar uma mensagem


CDK4 polyclonal antibody (A01)

CDK4 polyclonal antibody (A01)