CDK2 monoclonal antibody (M02), clone 2E8
  • CDK2 monoclonal antibody (M02), clone 2E8

CDK2 monoclonal antibody (M02), clone 2E8

Ref: AB-H00001017-M02
CDK2 monoclonal antibody (M02), clone 2E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDK2.
Información adicional
Size 100 ug
Gene Name CDK2
Gene Alias p33(CDK2)
Gene Description cyclin-dependent kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDK2 (AAH03065, 211 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1017
Clone Number 2E8
Iso type IgG1 kappa

Enviar uma mensagem


CDK2 monoclonal antibody (M02), clone 2E8

CDK2 monoclonal antibody (M02), clone 2E8