CDH11 polyclonal antibody (A01)
  • CDH11 polyclonal antibody (A01)

CDH11 polyclonal antibody (A01)

Ref: AB-H00001009-A01
CDH11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDH11.
Información adicional
Size 50 uL
Gene Name CDH11
Gene Alias CAD11|CDHOB|OB|OSF-4
Gene Description cadherin 11, type 2, OB-cadherin (osteoblast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH11 (NP_001788, 509 a.a. ~ 617 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1009

Enviar uma mensagem


CDH11 polyclonal antibody (A01)

CDH11 polyclonal antibody (A01)