CDH8 polyclonal antibody (A01)
  • CDH8 polyclonal antibody (A01)

CDH8 polyclonal antibody (A01)

Ref: AB-H00001006-A01
CDH8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDH8.
Información adicional
Size 50 uL
Gene Name CDH8
Gene Alias Nbla04261
Gene Description cadherin 8, type 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH8 (NP_001787, 522 a.a. ~ 621 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1006

Enviar uma mensagem


CDH8 polyclonal antibody (A01)

CDH8 polyclonal antibody (A01)