CDH2 monoclonal antibody (M06), clone 5E6
  • CDH2 monoclonal antibody (M06), clone 5E6

CDH2 monoclonal antibody (M06), clone 5E6

Ref: AB-H00001000-M06
CDH2 monoclonal antibody (M06), clone 5E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDH2.
Información adicional
Size 100 ug
Gene Name CDH2
Gene Alias CD325|CDHN|CDw325|NCAD
Gene Description cadherin 2, type 1, N-cadherin (neuronal)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH2 (NP_001783, 807 a.a. ~ 906 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1000
Clone Number 5E6
Iso type IgG2a Kappa

Enviar uma mensagem


CDH2 monoclonal antibody (M06), clone 5E6

CDH2 monoclonal antibody (M06), clone 5E6