CDC27 purified MaxPab mouse polyclonal antibody (B01P)
  • CDC27 purified MaxPab mouse polyclonal antibody (B01P)

CDC27 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000996-B01P
CDC27 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CDC27 protein.
Información adicional
Size 50 ug
Gene Name CDC27
Gene Alias APC3|CDC27Hs|D0S1430E|D17S978E|HNUC
Gene Description cell division cycle 27 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC27 (ABM87026.1, 1 a.a. ~ 830 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 996

Enviar uma mensagem


CDC27 purified MaxPab mouse polyclonal antibody (B01P)

CDC27 purified MaxPab mouse polyclonal antibody (B01P)