CDC25C monoclonal antibody (M01), clone 3B11
  • CDC25C monoclonal antibody (M01), clone 3B11

CDC25C monoclonal antibody (M01), clone 3B11

Ref: AB-H00000995-M01
CDC25C monoclonal antibody (M01), clone 3B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC25C.
Información adicional
Size 100 ug
Gene Name CDC25C
Gene Alias CDC25
Gene Description cell division cycle 25 homolog C (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC25C (AAH19089, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 995
Clone Number 3B11
Iso type IgG1 Kappa

Enviar uma mensagem


CDC25C monoclonal antibody (M01), clone 3B11

CDC25C monoclonal antibody (M01), clone 3B11