CDC25A MaxPab rabbit polyclonal antibody (D01)
  • CDC25A MaxPab rabbit polyclonal antibody (D01)

CDC25A MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000993-D01
CDC25A MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDC25A protein.
Información adicional
Size 100 uL
Gene Name CDC25A
Gene Alias CDC25A2
Gene Description cell division cycle 25 homolog A (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYEQPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALKRSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTTNLDNR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC25A (NP_001780.2, 1 a.a. ~ 524 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 993

Enviar uma mensagem


CDC25A MaxPab rabbit polyclonal antibody (D01)

CDC25A MaxPab rabbit polyclonal antibody (D01)