CDC20 purified MaxPab rabbit polyclonal antibody (D01P)
  • CDC20 purified MaxPab rabbit polyclonal antibody (D01P)

CDC20 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000991-D01P
CDC20 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDC20 protein.
Información adicional
Size 100 ug
Gene Name CDC20
Gene Alias CDC20A|MGC102824|bA276H19.3|p55CDC
Gene Description cell division cycle 20 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWVLNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC20 (AAH00624.1, 1 a.a. ~ 499 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 991

Enviar uma mensagem


CDC20 purified MaxPab rabbit polyclonal antibody (D01P)

CDC20 purified MaxPab rabbit polyclonal antibody (D01P)