CDC6 polyclonal antibody (A01)
  • CDC6 polyclonal antibody (A01)

CDC6 polyclonal antibody (A01)

Ref: AB-H00000990-A01
CDC6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDC6.
Información adicional
Size 50 uL
Gene Name CDC6
Gene Alias CDC18L|HsCDC18|HsCDC6
Gene Description cell division cycle 6 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC6 (NP_001245, 434 a.a. ~ 533 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 990

Enviar uma mensagem


CDC6 polyclonal antibody (A01)

CDC6 polyclonal antibody (A01)