SEPT7 purified MaxPab mouse polyclonal antibody (B01P)
  • SEPT7 purified MaxPab mouse polyclonal antibody (B01P)

SEPT7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000989-B01P
SEPT7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SEPT7 protein.
Información adicional
Size 50 ug
Gene Name SEPT7
Gene Alias CDC10|CDC3|Nbla02942|SEPT7A
Gene Description septin 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEPT7 (NP_001779, 1 a.a. ~ 418 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 989

Enviar uma mensagem


SEPT7 purified MaxPab mouse polyclonal antibody (B01P)

SEPT7 purified MaxPab mouse polyclonal antibody (B01P)